Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3EAP Peptide - middle region

CD3EAP Peptide - middle region

Product Specifications

Product Name Alternative

ASE1, CAST, ASE-1, PAF49

UniProt

O15446

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001284519.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLKEPEAAGPVGTEPTVETLEPLGVLFPSTTKKRKKPKGKETFEPEDKTV

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKNK2 Protein Vector (Rat) (pPM-C-HA)
30170026 500 ng

MKNK2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PCDH15 (NM_001142769) Human Tagged ORF Clone
RC226910 10 µg

PCDH15 (NM_001142769) Human Tagged ORF Clone

Sign In for Pricing
View Details
M mgT1 Mouse Monoclonal Antibody [Clone:7B9]
E45M20049 100 µg

M mgT1 Mouse Monoclonal Antibody [Clone:7B9]

Sign In for Pricing
View Details
C10orf110-set siRNA/shRNA/RNAi Lentivector (Human)
53555091 4x 500 ng

C10orf110-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
2-Azidoethyl β-D-glucopyranoside
GC5576-100mg 100 mg

2-Azidoethyl β-D-glucopyranoside

Sign In for Pricing
View Details
HDAC6 Rabbit Polyclonal Antibody
E53P12287 100 µL

HDAC6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details