Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP8 Peptide - middle region

AKAP8 Peptide - middle region

Product Specifications

Product Name Alternative

AKAP-8, AKAP95, AKAP 95, AKAP-95

UniProt

O43823

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005849.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDGTGRKRKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERRFI1 (NM_018948) Human Over-expression Lysate
LY402716 100 µg

ERRFI1 (NM_018948) Human Over-expression Lysate

Sign In for Pricing
View Details
PerCP Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013F-01 50 Tests

PerCP Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013F-02 100 Tests

PerCP Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013F-03 2x 100 Tests

PerCP Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2590), 0.2mg/mL
BNUB2590-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/2590), 0.2mg/mL

Sign In for Pricing
View Details
Terlipressin-Phe(d5) Diacetate Salt
TRC-T115802-5MG 5 mg

Terlipressin-Phe(d5) Diacetate Salt

Sign In for Pricing
View Details