CES1C Peptide - C-terminal region
CES1C Peptide - C-terminal region
Product Specifications
Product Name Alternative
Ee1, Es1, Es4, EsN, Ee-1, Es-4, Es-N, PESN, Ces-N
UniProt
P23953
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_031980.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10440126 96 Well
Chicken Apoptosis inducing factor 2 (AIFM2) ELISA kit
Sign In for Pricing
View Details 
MBS1132634-01 0.02 mg (E-Coli)
Recombinant Escherichia coli Cysteine desulfuration protein sufE (sufE)
Sign In for Pricing
View Details