Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES1C Peptide - C-terminal region

CES1C Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ee1, Es1, Es4, EsN, Ee-1, Es-4, Es-N, PESN, Ces-N

UniProt

P23953

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031980.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human C1QTNF1 Protein-GST tag
CTP-152 100 µg

Recombinant Human C1QTNF1 Protein-GST tag

Sign In for Pricing
View Details
Dnajc16 3'UTR GFP Stable Cell Line
TU253523 1.0 mL

Dnajc16 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
E2F7 Protein Vector (Rat) (pPM-C-HA)
18837026 500 ng

E2F7 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-CD40L [AT161-8]
MBS488577-01 0.2 mg

Anti-CD40L [AT161-8]

Sign In for Pricing
View Details
Anti-CD40L [AT161-8]
MBS488577-02 5x 0.2 mg

Anti-CD40L [AT161-8]

Sign In for Pricing
View Details
Recombinant Anti-MRPS31 Rabbit mAb
CMA4919-01 30 µL

Recombinant Anti-MRPS31 Rabbit mAb

Sign In for Pricing
View Details