Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD3B2 Peptide - middle region

HSD3B2 Peptide - middle region

Product Specifications

Product Name Alternative

Hsd3b1, Hsd3b6, Hsd3b2l1

UniProt

O35469

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_058961.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPNSYKKIILNGHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF3A3 Antibody
C46221-01 50 μL

SF3A3 Antibody

Sign In for Pricing
View Details
SF3A3 Antibody
C46221-02 100 µL

SF3A3 Antibody

Sign In for Pricing
View Details
Anti-Mouse IgG1 Fc Antibody (SAA0489)
MV080073-01 50 µg

Anti-Mouse IgG1 Fc Antibody (SAA0489)

Sign In for Pricing
View Details
Anti-Mouse IgG1 Fc Antibody (SAA0489)
MV080073-02 100 µg

Anti-Mouse IgG1 Fc Antibody (SAA0489)

Sign In for Pricing
View Details
TMEM191C CRISPR Activation Plasmid (m)
sc-432422-ACT 20 µg

TMEM191C CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
ACOT4 Protein Lysate (Rat) with C-HA Tag
11189036 100 µg

ACOT4 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details