Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD3B2 Peptide - middle region

HSD3B2 Peptide - middle region

Product Specifications

Product Name Alternative

Hsd3b1, Hsd3b6, Hsd3b2l1

UniProt

O35469

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_058961.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPNSYKKIILNGHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B-RAF (Ab-446) Antibody
MBS8586819-01 0.1 mg

B-RAF (Ab-446) Antibody

Sign In for Pricing
View Details
B-RAF (Ab-446) Antibody
MBS8586819-02 0.1 mL (AF405L)

B-RAF (Ab-446) Antibody

Sign In for Pricing
View Details
B-RAF (Ab-446) Antibody
MBS8586819-03 0.1 mL (AF405S)

B-RAF (Ab-446) Antibody

Sign In for Pricing
View Details
B-RAF (Ab-446) Antibody
MBS8586819-04 0.1 mL (AF610)

B-RAF (Ab-446) Antibody

Sign In for Pricing
View Details
B-RAF (Ab-446) Antibody
MBS8586819-05 0.1 mL (AF635)

B-RAF (Ab-446) Antibody

Sign In for Pricing
View Details
B-RAF (Ab-446) Antibody
MBS8586819-06 0.1 mL (APC)

B-RAF (Ab-446) Antibody

Sign In for Pricing
View Details