Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMYC Peptide - middle region

BMYC Peptide - middle region

Product Specifications

Product Name Alternative

Mycb, AW060705, 2900002K07Rik

UniProt

Q6P8Z1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075815.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CDDEEEDVHHQQPPQPPAPSEDIWKKFELLPTPRPSPGHAGLYSPPCEAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHKA1 (NM_002637) Human Recombinant Protein
TP311553 20 µg

PHKA1 (NM_002637) Human Recombinant Protein

Sign In for Pricing
View Details
ERCC1 Human Gene Knockout Kit (CRISPR)
KN200478LP 1 Kit

ERCC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FGF13 (B Isoform) Mouse Monoclonal Antibody [Clone ID: N225A/10]
75-248 100 µL

FGF13 (B Isoform) Mouse Monoclonal Antibody [Clone ID: N225A/10]

Sign In for Pricing
View Details
Mouse Chaperonin Containing TCP1, Subunit 2 (CCT2) ELISA Kit
RD-CCT2-Mu-01 96 Tests

Mouse Chaperonin Containing TCP1, Subunit 2 (CCT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Chaperonin Containing TCP1, Subunit 2 (CCT2) ELISA Kit
RD-CCT2-Mu-02 48 Tests

Mouse Chaperonin Containing TCP1, Subunit 2 (CCT2) ELISA Kit

Sign In for Pricing
View Details
Clec1b Rat Monoclonal Antibody [Clone ID: 17D9]
AM60018FC-N 100 µg

Clec1b Rat Monoclonal Antibody [Clone ID: 17D9]

Sign In for Pricing
View Details