Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMYC Peptide - middle region

BMYC Peptide - middle region

Product Specifications

Product Name Alternative

Mycb, AW060705, 2900002K07Rik

UniProt

Q6P8Z1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075815.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CDDEEEDVHHQQPPQPPAPSEDIWKKFELLPTPRPSPGHAGLYSPPCEAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Limax flavus Lectin (Garden Slug) -LFA-,  40nm
GP-5101-40 1 mL

Colloidal Gold Conjugated Limax flavus Lectin (Garden Slug) -LFA-, 40nm

Sign In for Pricing
View Details
BPI Rabbit Polyclonal Antibody
TA360919 100 µL

BPI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TentaGel® HL NH₂
HL12902.25G 25 g

TentaGel® HL NH₂

Sign In for Pricing
View Details
Benchtop Shaking Incubator BSBT-2201
BSBT-2201 1 Unit

Benchtop Shaking Incubator BSBT-2201

Sign In for Pricing
View Details
Granulocyte Marker (BM-1), CF568 conjugate, 0.1mg/mL
BNC680061-100 1x 100 µL

Granulocyte Marker (BM-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tert-butyl Acetate
TRC-T886480-50G 50 g

Tert-butyl Acetate

Sign In for Pricing
View Details