Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR484 Peptide - C-terminal region

OLFR484 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-16

UniProt

Q8VFD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666710.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSRYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALRRHLGKKIFSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARD10 Antibody
8C12112-AAT 50 µg

CARD10 Antibody

Sign In for Pricing
View Details
Nuclear Factor 1 (NFIA) (NM_001134673) Human Over-expression Lysate
LC427477 20 µg

Nuclear Factor 1 (NFIA) (NM_001134673) Human Over-expression Lysate

Sign In for Pricing
View Details
Tmem40 Mouse Gene Knockout Kit (CRISPR)
KN517861 1 Kit

Tmem40 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Golga7b activation kit by CRISPRa
GA208742 1 Kit

Mouse Golga7b activation kit by CRISPRa

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (CALNA/2353), 0.2mg/mL
BNUB2353-100 1x 100 µL

Calcineurin A / PPP3CA (CALNA/2353), 0.2mg/mL

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/2403), CF640R conjugate, 0.1mg/mL
BNC402403-100 1x 100 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/2403), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details