Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR484 Peptide - C-terminal region

OLFR484 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-16

UniProt

Q8VFD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666710.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSRYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALRRHLGKKIFSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FAM3C Protein (His Tag)
PKSH032962-01 10 µg

Recombinant Human FAM3C Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FAM3C Protein (His Tag)
PKSH032962-02 50 µg

Recombinant Human FAM3C Protein (His Tag)

Sign In for Pricing
View Details
CABP5 (NM_019855) Human Recombinant Protein
TP313946 20 µg

CABP5 (NM_019855) Human Recombinant Protein

Sign In for Pricing
View Details
4-Ethylcatechol
TRC-E901760-5G 5 g

4-Ethylcatechol

Sign In for Pricing
View Details
Texas Red Conjugated Robinia pseudoacacia (Black Locust) -RPA-
T-4101-1 1 mg

Texas Red Conjugated Robinia pseudoacacia (Black Locust) -RPA-

Sign In for Pricing
View Details
Recombinant Dromedary camel coronavirus (DcCoV) (strain HKU23-368F) Nucleoprotein / DcCoV-NP Protein (His Tag)
PKSV030134 100 µg

Recombinant Dromedary camel coronavirus (DcCoV) (strain HKU23-368F) Nucleoprotein / DcCoV-NP Protein (His Tag)

Sign In for Pricing
View Details