What is the catalog number for GSTP1 Peptide - middle region?

The catalog number for GSTP1 Peptide - middle region is orb1998153.

What sizes are available for GSTP1 Peptide - middle region?

GSTP1 Peptide - middle region is available in the following size(s): 100 µg.

Is GSTP1 Peptide - middle region in stock?

GSTP1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GSTP1 Peptide - middle region

Product Specifications

Product Name Alternative

GstpiB

UniProt

P19157

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_038569.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTLIYTNYENGKNDYVKALPGHLKPFETLLSQNQGGKAFIVGDQISFADY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb2668328-01 10 µg

Cynomolgus SEZ6 Protein, His Tag

Sign In for Pricing

View Details

orb2668328-02 50 µg

Cynomolgus SEZ6 Protein, His Tag

Sign In for Pricing

View Details

orb2668328-03 100 µg

Cynomolgus SEZ6 Protein, His Tag

Sign In for Pricing

View Details

orb1948672-01 48 Tests

Human Endothelin Converting Enzyme 1 (ECE1) ELISA Kit

Sign In for Pricing

View Details

orb1948672-02 96 Tests

Human Endothelin Converting Enzyme 1 (ECE1) ELISA Kit

Sign In for Pricing

View Details

70R-20165 50 ul

SERPINA1 antibody

Sign In for Pricing

View Details