Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNH Peptide - C-terminal region

CCNH Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI661354, AV102684, AW538719, 6330408H09Rik

UniProt

Q3UUW5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075732.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPPRSDEVAVLKQKLERCHSSDLALNAVTKKRKGYEDDDYVSKKPKQEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L2 / PDCD1LG2 / CD273 (PDL2/1850), CF594 conjugate, 0.1mg/mL
BNC941850-100 1x 100 µL

PD-L2 / PDCD1LG2 / CD273 (PDL2/1850), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Dnase1l3 activation kit by CRISPRa
GA201100 1 Kit

Mouse Dnase1l3 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Nitro-m-toluic Acid
TRC-N572300-10G 10 g

2-Nitro-m-toluic Acid

Sign In for Pricing
View Details
Borrelia burgdorferi (p41 Flagellin) (6802), 0.2mg/mL
BNUB0144-500 1x 500 µL

Borrelia burgdorferi (p41 Flagellin) (6802), 0.2mg/mL

Sign In for Pricing
View Details
FOXQ1 Rabbit Polyclonal Antibody
TA368338 100 µL

FOXQ1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504700 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details