Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNH Peptide - C-terminal region

CCNH Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI661354, AV102684, AW538719, 6330408H09Rik

UniProt

Q3UUW5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075732.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPPRSDEVAVLKQKLERCHSSDLALNAVTKKRKGYEDDDYVSKKPKQEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Lung: left upper lobe
CD563538 5 µg

Tissue Genomic DNA, Lung: left upper lobe

Sign In for Pricing
View Details
EDF1 (NM_153200) Human Recombinant Protein
TP312036M 100 µg

EDF1 (NM_153200) Human Recombinant Protein

Sign In for Pricing
View Details
PDLIM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11A12]
TA502731BM 100 µL

PDLIM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11A12]

Sign In for Pricing
View Details
n-Heptane
TRC-H281145-5ML 5 mL

n-Heptane

Sign In for Pricing
View Details
DL-Carnitine Benzyl Ester Chloride
TRC-C184135-250MG 250 mg

DL-Carnitine Benzyl Ester Chloride

Sign In for Pricing
View Details
PNPLA7 Human Gene Knockout Kit (CRISPR)
KN417687 1 Kit

PNPLA7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details