Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD209D Peptide - middle region

CD209D Peptide - middle region

Product Specifications

Product Name Alternative

SIGNR3, SIGN-R3, mSIGNR3

UniProt

Q91ZW8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_570974.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DMHNEATWHWVDGSPLSPSFTRYWNRGEPNNVGDEDCAEFSGDGWNDLSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 4-Hydroxyphenylpyruvate Dioxygenase (HPD) ELISA Kit
orb1665853-01 48 Tests

Human 4-Hydroxyphenylpyruvate Dioxygenase (HPD) ELISA Kit

Sign In for Pricing
View Details
Human 4-Hydroxyphenylpyruvate Dioxygenase (HPD) ELISA Kit
orb1665853-02 96 Tests

Human 4-Hydroxyphenylpyruvate Dioxygenase (HPD) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Ralgapa2 shRNA (UAS) - Lentiviral mouse Ralgapa2 shRNA (UAS) (25)
GTR15176033 1 Vial

Lentiviral mouse Ralgapa2 shRNA (UAS) - Lentiviral mouse Ralgapa2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rat High mobility group protein B1 (HMGB-1) ELISA Kit
MBS265968-01 48 Well

Rat High mobility group protein B1 (HMGB-1) ELISA Kit

Sign In for Pricing
View Details
Rat High mobility group protein B1 (HMGB-1) ELISA Kit
MBS265968-02 96 Well

Rat High mobility group protein B1 (HMGB-1) ELISA Kit

Sign In for Pricing
View Details
Rat High mobility group protein B1 (HMGB-1) ELISA Kit
MBS265968-03 5x 96 Well

Rat High mobility group protein B1 (HMGB-1) ELISA Kit

Sign In for Pricing
View Details