Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP5Z1 Peptide - middle region

AP5Z1 Peptide - middle region

Product Specifications

Product Name Alternative

AP-5 complex subunit zeta-1

UniProt

O43299

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055670.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS713222 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
HOXD3 Rabbit Polyclonal Antibody
TA371903 100 µL

HOXD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF488A conjugate, 0.1mg/mL
BNC881260-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Chad activation kit by CRISPRa
GA200710 1 Kit

Mouse Chad activation kit by CRISPRa

Sign In for Pricing
View Details
Human UGT3A2 activation kit by CRISPRa
GA116153 1 Kit

Human UGT3A2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Cytokeratin-9 Antibody
RC-5679-01 50 μL

Recombinant Cytokeratin-9 Antibody

Sign In for Pricing
View Details