MAPKAP1 Peptide - middle region
MAPKAP1 Peptide - middle region
Product Specifications
Product Name Alternative
Target of rapamycin complex 2 subunit MAPKAP1
UniProt
Q8BKH7
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001277554.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISID
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-6916R-APC-Cy5.5 100 µL
RABX5 Polyclonal Antibody, APC-Cy5.5 Conjugated
Sign In for Pricing
View Details 
EKU03102 96 Tests
Human Chemokine C-C-Motif Receptor 4 (CCR4) ELISA Kit
Sign In for Pricing
View Details PA1417-PE 100 µg/Vial
Anti-Thrombospondin 2/THBS2 Antibody Picoband®, PE Conjugate
Sign In for Pricing
View Details 
bsm-62200R-BF647-01 20 µL
FE65 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
Sign In for Pricing
View Details