MAPKAP1 Peptide - middle region
MAPKAP1 Peptide - middle region
Product Specifications
Product Name Alternative
Target of rapamycin complex 2 subunit MAPKAP1
UniProt
Q8BKH7
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001277554.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISID
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15257693 1 Vial
Lentiviral mouse Fam174a shRNA (UAS) - Lentiviral mouse Fam174a shRNA (UAS) (25)
Sign In for Pricing
View Details 
GTR15091875 1 Vial
Lentiviral human EUAS1 shRNA (UAS) - Lentiviral human EUAS1 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details