Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSB Peptide - middle region

CTSB Peptide - middle region

Product Specifications

Product Name Alternative

APPS, CPSB

UniProt

P07858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001899.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brain Microdialysis Surgery Instrument Kit for Mice
SP0004-M 1 PC

Brain Microdialysis Surgery Instrument Kit for Mice

Sign In for Pricing
View Details
C3a ELISA Kit (Canine) (OKAN04423)
OKAN04423 96 Well

C3a ELISA Kit (Canine) (OKAN04423)

Sign In for Pricing
View Details
Hydrophobic filter, pk/1 (1 each included)
V0020-F1 1 Each

Hydrophobic filter, pk/1 (1 each included)

Sign In for Pricing
View Details
Ugdh siRNA Oligos set (Rat)
49099176 3x 5 nmol

Ugdh siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Anpirtoline hydrochloride
orb2901481-01 1 g

Anpirtoline hydrochloride

Sign In for Pricing
View Details
Anpirtoline hydrochloride
orb2901481-02 2 mg

Anpirtoline hydrochloride

Sign In for Pricing
View Details