Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSB Peptide - middle region

CTSB Peptide - middle region

Product Specifications

Product Name Alternative

APPS, CPSB

UniProt

P07858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001899.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bad (NM_007522) Mouse Untagged Clone
MC208172 10 µg

Bad (NM_007522) Mouse Untagged Clone

Sign In for Pricing
View Details
Anti-TPPP3 Antibody Picoband® APC Conjugated
A13192-1-APC 100 µg/Vial

Anti-TPPP3 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
Ser/thr-PP2A activator  Rabbit pAb
E45R24455N 50 ul

Ser/thr-PP2A activator Rabbit pAb

Sign In for Pricing
View Details
STK3 (Serine/Threonine Kinase 3 (STE20 Homolog, yeast), FLJ90748, KRS1, MST2) (MaxLight 405)
MBS6198104-01 0.1 mL

STK3 (Serine/Threonine Kinase 3 (STE20 Homolog, yeast), FLJ90748, KRS1, MST2) (MaxLight 405)

Sign In for Pricing
View Details
STK3 (Serine/Threonine Kinase 3 (STE20 Homolog, yeast), FLJ90748, KRS1, MST2) (MaxLight 405)
MBS6198104-02 5x 0.1 mL

STK3 (Serine/Threonine Kinase 3 (STE20 Homolog, yeast), FLJ90748, KRS1, MST2) (MaxLight 405)

Sign In for Pricing
View Details
Deltex 1 Rabbit pAb, PerCP-Cy7 conjugated
orb2882669 100 µL

Deltex 1 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details