Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGAX Peptide - N-terminal region

ITGAX Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cr4, N418, Cd11c, AI449405

UniProt

Q9QXH4

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067309.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THFHMDGAEFGHSVLQYDSSWVVVGAPKEIKATNQIGGLYKCGYHTGNCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CABLES2 activation kit by CRISPRa
GA113154 1 Kit

Human CABLES2 activation kit by CRISPRa

Sign In for Pricing
View Details
NDRG1 (N-term) Rabbit Polyclonal Antibody
AP17582PU-N 400 µL

NDRG1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GATA4 (NM_002052) Human Over-expression Lysate
LC419558 20 µg

GATA4 (NM_002052) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CDK5RAP3 protein (His tag)
PDEH101067-01 20 µg

Recombinant Human CDK5RAP3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CDK5RAP3 protein (His tag)
PDEH101067-02 100 µg

Recombinant Human CDK5RAP3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CDK5RAP3 protein (His tag)
PDEH101067-03 500 µg

Recombinant Human CDK5RAP3 protein (His tag)

Sign In for Pricing
View Details