Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGAX Peptide - N-terminal region

ITGAX Peptide - N-terminal region

Product Specifications

Product Name Alternative

Cr4, N418, Cd11c, AI449405

UniProt

Q9QXH4

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067309.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THFHMDGAEFGHSVLQYDSSWVVVGAPKEIKATNQIGGLYKCGYHTGNCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-100 1x 100 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-Tau (T231) Recombinant Rabbit monoclonal Antibody
HA750679 100 µL

Phospho-Tau (T231) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
5(6)-Carboxyfluorescein
TRC-C178315-1G 1 g

5(6)-Carboxyfluorescein

Sign In for Pricing
View Details
Human CCDC13 activation kit by CRISPRa
GA115828 1 Kit

Human CCDC13 activation kit by CRISPRa

Sign In for Pricing
View Details
Slc33a1 Mouse Gene Knockout Kit (CRISPR)
KN516050 1 Kit

Slc33a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/2111), CF488A conjugate, 0.1mg/mL
BNC882111-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/2111), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details