Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A13 Peptide - N-terminal region

SLC7A13 Peptide - N-terminal region

Product Specifications

UniProt

Q5RKI7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001012100

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAMDIEKKIYLKRQLGYFWGTNFLIINIIGAGIFVSPKGVLQYSSMNVGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Periostin Rabbit Monoclonal Antibody, 1 pack = 20 µL
BAL5893 1 Each

Periostin Rabbit Monoclonal Antibody, 1 pack = 20 µL

Sign In for Pricing
View Details
ZNF594 (NM_032530) Human Tagged ORF Clone
RG221274 10 µg

ZNF594 (NM_032530) Human Tagged ORF Clone

Sign In for Pricing
View Details
SLC6A2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV661736 1.0 µg DNA

SLC6A2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ZADH1 Peptide - middle region
MBS3236026-01 0.1 mg

ZADH1 Peptide - middle region

Sign In for Pricing
View Details
ZADH1 Peptide - middle region
MBS3236026-02 5x 0.1 mg

ZADH1 Peptide - middle region

Sign In for Pricing
View Details
pCMV-ZNF717-3×FLAG-Neo Plasmid
PVT63231 2 µg

pCMV-ZNF717-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details