Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A13 Peptide - N-terminal region

SLC7A13 Peptide - N-terminal region

Product Specifications

UniProt

Q5RKI7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001012100

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAMDIEKKIYLKRQLGYFWGTNFLIINIIGAGIFVSPKGVLQYSSMNVGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PISD Antibody, Biotin conjugated
CSB-PA880077LD01HU-01 50 µg

PISD Antibody, Biotin conjugated

Sign In for Pricing
View Details
PISD Antibody, Biotin conjugated
CSB-PA880077LD01HU-02 100 µg

PISD Antibody, Biotin conjugated

Sign In for Pricing
View Details
LIN28B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1217607 1.0 µg DNA

LIN28B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Nlgn2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4869702 1.0 µg DNA

Nlgn2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Lentiviral human ZHX1-C8orf76 shRNA (UAS) - Lentiviral human ZHX1-C8orf76 shRNA (UAS, GFP) (100)
GTR15330672 1 Vial

Lentiviral human ZHX1-C8orf76 shRNA (UAS) - Lentiviral human ZHX1-C8orf76 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Anti-NDUFC2 Rabbit Monoclonal Antibody
MA3910-.1 100 µL

Anti-NDUFC2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details