Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G7 Peptide - middle region

PLA2G7 Peptide - middle region

Product Specifications

Product Name Alternative

PAFAD, PAFAH, LP-PLA2, LDL-PLA2

UniProt

Q13093

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001161829.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AWAT2, CT (AWAT2, DC4, DGAT2L4, MFAT, WS, Acyl-CoA wax alcohol acyltransferase 2, Acyl-CoA retinol O-fatty-acyltransferase, Diacylglycerol O-acyltransferase 2-like protein 4, Diacylglycerol O-acyltransferase candidate 4, Long-chain-alcohol O-fatty-acyltra
MBS6276993-01 0.1 mL

AWAT2, CT (AWAT2, DC4, DGAT2L4, MFAT, WS, Acyl-CoA wax alcohol acyltransferase 2, Acyl-CoA retinol O-fatty-acyltransferase, Diacylglycerol O-acyltransferase 2-like protein 4, Diacylglycerol O-acyltransferase candidate 4, Long-chain-alcohol O-fatty-acyltra

Sign In for Pricing
View Details
AWAT2, CT (AWAT2, DC4, DGAT2L4, MFAT, WS, Acyl-CoA wax alcohol acyltransferase 2, Acyl-CoA retinol O-fatty-acyltransferase, Diacylglycerol O-acyltransferase 2-like protein 4, Diacylglycerol O-acyltransferase candidate 4, Long-chain-alcohol O-fatty-acyltra
MBS6276993-02 5x 0.1 mL

AWAT2, CT (AWAT2, DC4, DGAT2L4, MFAT, WS, Acyl-CoA wax alcohol acyltransferase 2, Acyl-CoA retinol O-fatty-acyltransferase, Diacylglycerol O-acyltransferase 2-like protein 4, Diacylglycerol O-acyltransferase candidate 4, Long-chain-alcohol O-fatty-acyltra

Sign In for Pricing
View Details
Porcine DβH (Dopamine-β-Hydroxylase) ValidElisa Kit
EK345214 96 Well

Porcine DβH (Dopamine-β-Hydroxylase) ValidElisa Kit

Sign In for Pricing
View Details
Rabbit Polyclonal LOX Antibody
NB100-2530 0.05 mL

Rabbit Polyclonal LOX Antibody

Sign In for Pricing
View Details
Mouse Fc gamma RI/CD64 Alexa Fluor 405 Antibody
FAB20741V-100UG 100 µg

Mouse Fc gamma RI/CD64 Alexa Fluor 405 Antibody

Sign In for Pricing
View Details
POLH Antibody
orb794215 2 mg

POLH Antibody

Sign In for Pricing
View Details