Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF4 Peptide - middle region

ATF4 Peptide - middle region

Product Specifications

Product Name Alternative

Atf-4, C/ATF, CREB2, TAXREB67

UniProt

Q06507

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001274109.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish MYOD1 Rabbit Polyclonal Antibody (Carrier-free)
orb3089414 100 µg

Zebrafish MYOD1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Lysozyme G-Like Protein 2 (LYG2) Protein
abx262551-01 2 µg

Lysozyme G-Like Protein 2 (LYG2) Protein

Sign In for Pricing
View Details
Lysozyme G-Like Protein 2 (LYG2) Protein
abx262551-02 10 µg

Lysozyme G-Like Protein 2 (LYG2) Protein

Sign In for Pricing
View Details
Lysozyme G-Like Protein 2 (LYG2) Protein
abx262551-03 1 mg

Lysozyme G-Like Protein 2 (LYG2) Protein

Sign In for Pricing
View Details
Recombinant Human Phosphoglucomutase 1 (PGM1)
RPU51307-01 50 µg

Recombinant Human Phosphoglucomutase 1 (PGM1)

Sign In for Pricing
View Details
Recombinant Human Phosphoglucomutase 1 (PGM1)
RPU51307-02 100 µg

Recombinant Human Phosphoglucomutase 1 (PGM1)

Sign In for Pricing
View Details