What is the catalog number for CALHM2 Peptide - C-terminal region?

The catalog number for CALHM2 Peptide - C-terminal region is orb1997976.

What sizes are available for CALHM2 Peptide - C-terminal region?

CALHM2 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is CALHM2 Peptide - C-terminal region in stock?

CALHM2 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

CALHM2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Fam26b, RGD1308276

UniProt

Q5RJQ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008307

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EELVTKFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLHKWAQGLTGNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb750393 2 mL

Luciferase Antibody

Sign In for Pricing

View Details

SI017212A 1 Each

Human TPM2 Pre-designed siRNA Set A

Sign In for Pricing

View Details

T39744 25 mg

Firzacorvir

Sign In for Pricing

View Details

ELI-26889h 96 Tests

Human Clathrin interactor 1, CLINT1 ELISA KIT

Sign In for Pricing

View Details

TA502243 100 µL

GBP5 Mouse Monoclonal Antibody [Clone ID: OTI4D9]

Sign In for Pricing

View Details

abx316588-01 20 µg

NAD-Dependent Protein Deacetylase Sirtuin-3, Mitochondrial (SIRT3) Antibody (HRP)

Sign In for Pricing

View Details