SKP2 Peptide - middle region
SKP2 Peptide - middle region
Product Specifications
Product Name Alternative
P45, FBL1, FLB1, FBXL1
UniProt
Q13309
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001230049.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS029805-01 48 Well
Bovine Tissue Inhibitor of Metalloproteinases 1 ELISA Kit
Sign In for Pricing
View Details MBS029805-02 96 Well
Bovine Tissue Inhibitor of Metalloproteinases 1 ELISA Kit
Sign In for Pricing
View Details MBS029805-03 5x 96 Well
Bovine Tissue Inhibitor of Metalloproteinases 1 ELISA Kit
Sign In for Pricing
View Details MBS029805-04 10x 96 Well
Bovine Tissue Inhibitor of Metalloproteinases 1 ELISA Kit
Sign In for Pricing
View Details