Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNA2 Peptide - C-terminal region

KPNA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

QIP2, RCH1, IPOA1, SRP1alpha, SRP1-alpha

UniProt

P52292

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001307540.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC02210-CRHR1 Rabbit Polyclonal Antibody
AP01194PU-N 100 µg

LINC02210-CRHR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDK9 Rabbit Monoclonal Antibody [Clone ID: R03-5B9]
TA383973 100 µL

CDK9 Rabbit Monoclonal Antibody [Clone ID: R03-5B9]

Sign In for Pricing
View Details
SuLT2B1 (NM_177973) Human Recombinant Protein
TP304478L 1 mg

SuLT2B1 (NM_177973) Human Recombinant Protein

Sign In for Pricing
View Details
BTG2 Mouse Monoclonal Antibody [Clone ID: OTI5C7]
CF808155 100 µg

BTG2 Mouse Monoclonal Antibody [Clone ID: OTI5C7]

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS800768 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Atp2a3 Mouse Gene Knockout Kit (CRISPR)
KN501778 1 Kit

Atp2a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details