Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNA2 Peptide - C-terminal region

KPNA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

QIP2, RCH1, IPOA1, SRP1alpha, SRP1-alpha

UniProt

P52292

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001307540.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor I (CFI) Human Gene Knockout Kit (CRISPR)
KN416645 1 Kit

Factor I (CFI) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BMX (NM_001721) Human Recombinant Protein
TP321915M 100 µg

BMX (NM_001721) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS633971 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
WASH3P Human qPCR Primer Pair (AK056232)
HP222134 200 Reactions

WASH3P Human qPCR Primer Pair (AK056232)

Sign In for Pricing
View Details
ZNF264 Mouse Monoclonal Antibody [Clone ID: OTI8F4]
CF810495 100 µg

ZNF264 Mouse Monoclonal Antibody [Clone ID: OTI8F4]

Sign In for Pricing
View Details
PKC mu (PRKD1) Rabbit Polyclonal Antibody
AP20992PU-N 100 µg

PKC mu (PRKD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details