SPO11 Peptide - middle region
SPO11 Peptide - middle region
Product Specifications
Product Name Alternative
Spo11a, Spo11b, AI449549
UniProt
Q9WTK8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001077428.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RSDSPKSVKKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC200426L3V 200 µL
RFC4 (NM_002916) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details C2262-52M 250 µg
CD11b (CD11 Antigen-like Family Member B, Cell Surface Glycoprotein MAC-1 Subunit alpha, CR-3 alpha Chain, CR3A, Integrin alpha M, Integrin alpha-M, ITGAM, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor)
Sign In for Pricing
View Details MBS1423559-01 0.02 mg (E-Coli)
Recombinant Granulibacter bethesdensis UDP-3-O-acylglucosamine N-acyltransferase (lpxD)
Sign In for Pricing
View Details MBS1423559-02 0.02 mg (Yeast)
Recombinant Granulibacter bethesdensis UDP-3-O-acylglucosamine N-acyltransferase (lpxD)
Sign In for Pricing
View Details