Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPO11 Peptide - middle region

SPO11 Peptide - middle region

Product Specifications

Product Name Alternative

Spo11a, Spo11b, AI449549

UniProt

Q9WTK8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001077428.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSDSPKSVKKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Top Cutter
2032040/1 1 Each

Top Cutter

Sign In for Pricing
View Details
Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His
E55P0583 50 µg

Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His

Sign In for Pricing
View Details
Mouse Monoclonal CETP Antibody (ATM192) [Biotin]
NB300-558B 0.1 mL

Mouse Monoclonal CETP Antibody (ATM192) [Biotin]

Sign In for Pricing
View Details
Anti-human IL-21 (Avizakimab Biosimilar)
BIO0655SM-20mg 20 mg

Anti-human IL-21 (Avizakimab Biosimilar)

Sign In for Pricing
View Details
Bone Morphogenetic Protein 7 (BMP7, OP-1, Osteogenic Protein-1) (MaxLight 490)
B2553-34C-ML490 100 µL

Bone Morphogenetic Protein 7 (BMP7, OP-1, Osteogenic Protein-1) (MaxLight 490)

Sign In for Pricing
View Details
Rdh7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
38773064 1.0 µg DNA

Rdh7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details