What is the catalog number for BUB3 Peptide - N-terminal region?

The catalog number for BUB3 Peptide - N-terminal region is orb1997920.

What sizes are available for BUB3 Peptide - N-terminal region?

BUB3 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is BUB3 Peptide - N-terminal region in stock?

BUB3 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

BUB3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C78067, AU019800, AU021329, AU043350, AW146323

UniProt

Q9WVA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001304279.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-76682 1 Kit

Rat Neuropeptide Y ELISA Kit (Colorimetric)

Sign In for Pricing

View Details

R0495-52-HRP 100 µL

Raf Kinase Inhibitor Protein, CT (RKIP) (HRP)

Sign In for Pricing

View Details

sc-275358 250 mg

2,4-dioxo-1,2,3,4-tetrahydropyrimidine-5-sulfonyl chloride

Sign In for Pricing

View Details

orb1599093 100 µL

NFKB p65 (acetyl K310) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing

View Details

orb1942109-01 1 mg

Cy 5 hydrazide

Sign In for Pricing

View Details

orb1942109-02 5 mg

Cy 5 hydrazide

Sign In for Pricing

View Details