Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCNA Peptide - middle region

PCNA Peptide - middle region

Product Specifications

Product Name Alternative

ATLD2

UniProt

P12004

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002583.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIT (Citron Rho-interacting Kinase, CRIK, STK21, Serine/Threonine Protein Kinase 21) (MaxLight 550)
MBS6411730-01 0.1 mL

CIT (Citron Rho-interacting Kinase, CRIK, STK21, Serine/Threonine Protein Kinase 21) (MaxLight 550)

Sign In for Pricing
View Details
CIT (Citron Rho-interacting Kinase, CRIK, STK21, Serine/Threonine Protein Kinase 21) (MaxLight 550)
MBS6411730-02 5x 0.1 mL

CIT (Citron Rho-interacting Kinase, CRIK, STK21, Serine/Threonine Protein Kinase 21) (MaxLight 550)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 alpha (MIP-1alpha, CCL3, LD78 alpha) (MaxLight 490)
MBS6198797-01 0.1 mL

Macrophage Inflammatory Protein 1 alpha (MIP-1alpha, CCL3, LD78 alpha) (MaxLight 490)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 alpha (MIP-1alpha, CCL3, LD78 alpha) (MaxLight 490)
MBS6198797-02 5x 0.1 mL

Macrophage Inflammatory Protein 1 alpha (MIP-1alpha, CCL3, LD78 alpha) (MaxLight 490)

Sign In for Pricing
View Details
Dinitrophenyl hapten Antibody (HRP)
orb1735889 0.5 mg

Dinitrophenyl hapten Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2)
MBS7020513-01 0.02 mg

Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2 (mnhE2)

Sign In for Pricing
View Details