CCNC Peptide - C-terminal region
CCNC Peptide - C-terminal region
Product Specifications
Product Name Alternative
CycC
UniProt
P24863
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001013417.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1151624-01 0.02 mg (E-Coli)
Recombinant Saccharomyces cerevisiae Ribonuclease MRP protein subunit SNM1 (SNM1)
Sign In for Pricing
View Details MBS1151624-02 0.1 mg (E-Coli)
Recombinant Saccharomyces cerevisiae Ribonuclease MRP protein subunit SNM1 (SNM1)
Sign In for Pricing
View Details MBS1151624-03 0.02 mg (Yeast)
Recombinant Saccharomyces cerevisiae Ribonuclease MRP protein subunit SNM1 (SNM1)
Sign In for Pricing
View Details MBS1151624-04 0.1 mg (Yeast)
Recombinant Saccharomyces cerevisiae Ribonuclease MRP protein subunit SNM1 (SNM1)
Sign In for Pricing
View Details MBS1151624-05 0.02 mg (Baculovirus)
Recombinant Saccharomyces cerevisiae Ribonuclease MRP protein subunit SNM1 (SNM1)
Sign In for Pricing
View Details