Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNC Peptide - C-terminal region

CCNC Peptide - C-terminal region

Product Specifications

Product Name Alternative

CycC

UniProt

P24863

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001013417.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF180 (NM_001278508) Human Untagged Clone
SC337164 10 µg

ZNF180 (NM_001278508) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal TRAILR1/TNFRSF10A Antibody (TR1.02) [mFluor Violet 500 SE]
NBP2-80069MFV500 0.1 mL

Mouse Monoclonal TRAILR1/TNFRSF10A Antibody (TR1.02) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
KChIP1 Polyclonal Antibody
E20-53569 100 µg

KChIP1 Polyclonal Antibody

Sign In for Pricing
View Details
(8S) -2-Bromo-α-Ergocryptine
sc-504025 5 mg

(8S) -2-Bromo-α-Ergocryptine

Sign In for Pricing
View Details
Anti-VEGF/Vegfa Picoband® Antibody-FITC Conjugate
A00045-2-FITC 100 µg/Vial

Anti-VEGF/Vegfa Picoband® Antibody-FITC Conjugate

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lipocalin Like Protein 1 (LCNL1)
MBS2085473 Inquire

APC-Linked Polyclonal Antibody to Lipocalin Like Protein 1 (LCNL1)

Sign In for Pricing
View Details