Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPH2 Peptide - middle region

TPH2 Peptide - middle region

Product Specifications

Product Name Alternative

Ntph, AU043594

UniProt

Q8CGV2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_775567.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLMYGTELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Skin Aspartic Protease ELISA kit
GTR10434602 96 Well

Sheep Skin Aspartic Protease ELISA kit

Sign In for Pricing
View Details
Ankar Mouse siRNA Oligo Duplex (Locus ID 319695)
SR422889 1 Kit

Ankar Mouse siRNA Oligo Duplex (Locus ID 319695)

Sign In for Pricing
View Details
TAF1L Rabbit Polyclonal Antibody (BF647)
orb2529207 100 µL

TAF1L Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Recombinant Human DDAH1 Protein, N-His
bs-100244P-01 20 µg

Recombinant Human DDAH1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DDAH1 Protein, N-His
bs-100244P-02 50 µg

Recombinant Human DDAH1 Protein, N-His

Sign In for Pricing
View Details
ASB4, CT (ASB4, Ankyrin repeat and SOCS box protein 4) (AP)
MBS6275556-01 0.2 mL

ASB4, CT (ASB4, Ankyrin repeat and SOCS box protein 4) (AP)

Sign In for Pricing
View Details