BOK Peptide - middle region
BOK Peptide - middle region
Product Specifications
Product Name Alternative
Mtd, matador
UniProt
O35425
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_058058.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGFRSHWLVATLCSFGRFL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
R2999-61C-FITC 200 µL
ROR2, CT (Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2, NTRKR2) (FITC) discontinued
Sign In for Pricing
View Details 11614061 1.0 µg DNA
AIS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details