BOK Peptide - middle region
BOK Peptide - middle region
Product Specifications
Product Name Alternative
Mtd, matador
UniProt
O35425
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_058058.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGFRSHWLVATLCSFGRFL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx337389-01 20 µg
PX Domain Containing Serine/threonine Kinase Like (PXK) Antibody (Biotin)
Sign In for Pricing
View Details abx337389-02 50 µg
PX Domain Containing Serine/threonine Kinase Like (PXK) Antibody (Biotin)
Sign In for Pricing
View Details abx337389-03 100 µg
PX Domain Containing Serine/threonine Kinase Like (PXK) Antibody (Biotin)
Sign In for Pricing
View Details abx337389-04 200 µg
PX Domain Containing Serine/threonine Kinase Like (PXK) Antibody (Biotin)
Sign In for Pricing
View Details abx337389-05 1 mg
PX Domain Containing Serine/threonine Kinase Like (PXK) Antibody (Biotin)
Sign In for Pricing
View Details 