Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESRRB Peptide - middle region

ESRRB Peptide - middle region

Product Specifications

Product Name Alternative

Err2, Errb, Nr3b2, Estrrb

UniProt

Q61539

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001152972.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Superoxide Dismutase 1 (SOD1) Mouse Monoclonal Antibody [Clone ID: 2F5]
AM01230PU-N 100 µg

Superoxide Dismutase 1 (SOD1) Mouse Monoclonal Antibody [Clone ID: 2F5]

Sign In for Pricing
View Details
Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), CF640R conjugate, 0.1mg/mL
BNC402241-500 1x 500 µL

Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Psmd11 Mouse Gene Knockout Kit (CRISPR)
KN514117 1 Kit

Psmd11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAP2K6 Antibody
KC-6333-01 50 μL

MAP2K6 Antibody

Sign In for Pricing
View Details
MAP2K6 Antibody
KC-6333-02 100 µL

MAP2K6 Antibody

Sign In for Pricing
View Details
MAP2K6 Antibody
KC-6333-03 1 mL

MAP2K6 Antibody

Sign In for Pricing
View Details