Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESRRB Peptide - middle region

ESRRB Peptide - middle region

Product Specifications

Product Name Alternative

Err2, Errb, Nr3b2, Estrrb

UniProt

Q61539

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001152972.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant FLAP Antibody
RC-16189-01 50 μL

Recombinant FLAP Antibody

Sign In for Pricing
View Details
Recombinant FLAP Antibody
RC-16189-02 100 µL

Recombinant FLAP Antibody

Sign In for Pricing
View Details
Recombinant FLAP Antibody
RC-16189-03 1 mL

Recombinant FLAP Antibody

Sign In for Pricing
View Details
PKC zeta (PRKCZ) pThr410 Rabbit Polyclonal Antibody
AP01667PU-N 100 µg

PKC zeta (PRKCZ) pThr410 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
6-Azauridine
TRC-A805108-500MG 500 mg

6-Azauridine

Sign In for Pricing
View Details
APPD (PLEKHF1) (NM_024310) Human Over-expression Lysate
LY402983 100 µg

APPD (PLEKHF1) (NM_024310) Human Over-expression Lysate

Sign In for Pricing
View Details