Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OGG1 Peptide - middle region

OGG1 Peptide - middle region

Product Specifications

Product Name Alternative

Mmh

UniProt

O08760

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035087.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FQGVRLLRQDPTECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Mouse REN (Renin) ELISA Kit
E-MSEL-M0035-01 24 Tests

Mini Sample Mouse REN (Renin) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse REN (Renin) ELISA Kit
E-MSEL-M0035-02 48 Tests

Mini Sample Mouse REN (Renin) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse REN (Renin) ELISA Kit
E-MSEL-M0035-03 96 Tests

Mini Sample Mouse REN (Renin) ELISA Kit

Sign In for Pricing
View Details
TRIM3 Polyclonal Antibody
E-AB-13574-01 20 µL

TRIM3 Polyclonal Antibody

Sign In for Pricing
View Details
TRIM3 Polyclonal Antibody
E-AB-13574-02 60 µL

TRIM3 Polyclonal Antibody

Sign In for Pricing
View Details
TRIM3 Polyclonal Antibody
E-AB-13574-03 120 µL

TRIM3 Polyclonal Antibody

Sign In for Pricing
View Details