Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OGG1 Peptide - middle region

OGG1 Peptide - middle region

Product Specifications

Product Name Alternative

Mmh

UniProt

O08760

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035087.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FQGVRLLRQDPTECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epstein-Barr Virus (LMP-1) (CS4), 0.2mg/mL
BNUB1744-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS4), 0.2mg/mL

Sign In for Pricing
View Details
Tcp10a Mouse Gene Knockout Kit (CRISPR)
KN517344 1 Kit

Tcp10a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Avibactam Sodium Salt
TRC-A794850-5MG 5 mg

Avibactam Sodium Salt

Sign In for Pricing
View Details
Sennoside A
TRC-S258805-250MG 250 mg

Sennoside A

Sign In for Pricing
View Details
Ferritin Light Chain Antibody
KC-10190-01 50 μL

Ferritin Light Chain Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Antibody
KC-10190-02 100 µL

Ferritin Light Chain Antibody

Sign In for Pricing
View Details