Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDHB Peptide - middle region

SDHB Peptide - middle region

Product Specifications

Product Name Alternative

0710008N11Rik

UniProt

Q9CQA3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075863.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDGLYECI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RWDD4A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV813534 1.0 µg DNA

RWDD4A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Human SLIT1 qPCR Primer Pair
QH22929S 200 Tests

Human SLIT1 qPCR Primer Pair

Sign In for Pricing
View Details
Monkey Regenerating Islet Derived Protein 3 Alpha,REG3a ELISA KIT
JOT-EK0041MK-01 48 Well

Monkey Regenerating Islet Derived Protein 3 Alpha,REG3a ELISA KIT

Sign In for Pricing
View Details
Monkey Regenerating Islet Derived Protein 3 Alpha,REG3a ELISA KIT
JOT-EK0041MK-02 96 Well

Monkey Regenerating Islet Derived Protein 3 Alpha,REG3a ELISA KIT

Sign In for Pricing
View Details
MIP1 beta antibody (biotin)
60R-MR004BT 0.025 mg

MIP1 beta antibody (biotin)

Sign In for Pricing
View Details
Olfactory receptor 52E4 discontinued
392534 200 µL

Olfactory receptor 52E4 discontinued

Sign In for Pricing
View Details