Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASS1 Peptide - middle region

ASS1 Peptide - middle region

Product Specifications

Product Name Alternative

ASS, fold, Ass-1, AA408052

UniProt

P16460

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031520.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKQHGIPIPVTPKSPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD3 Antibody[HIT3b]
AN00644D-01 20 Tests

PE Anti-Human CD3 Antibody[HIT3b]

Sign In for Pricing
View Details
PE Anti-Human CD3 Antibody[HIT3b]
AN00644D-02 100 Tests

PE Anti-Human CD3 Antibody[HIT3b]

Sign In for Pricing
View Details
PE Anti-Human CD3 Antibody[HIT3b]
AN00644D-03 2x 100 Tests

PE Anti-Human CD3 Antibody[HIT3b]

Sign In for Pricing
View Details
Lentiviral human HOXD9 sgRNA gene knockout kit - Lentiviral human HOXD9 sgRNA gene knockout kit (25)
GTR15357888 1 Vial

Lentiviral human HOXD9 sgRNA gene knockout kit - Lentiviral human HOXD9 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
ANP32D Antibody
orb45738-01 50 µg

ANP32D Antibody

Sign In for Pricing
View Details
ANP32D Antibody
orb45738-02 100 µg

ANP32D Antibody

Sign In for Pricing
View Details