Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASS1 Peptide - middle region

ASS1 Peptide - middle region

Product Specifications

Product Name Alternative

ASS, fold, Ass-1, AA408052

UniProt

P16460

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031520.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKQHGIPIPVTPKSPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BSA Conjugated Lipopolysaccharides (LPS)
MBS2086469-01 0.01 mg

BSA Conjugated Lipopolysaccharides (LPS)

Sign In for Pricing
View Details
BSA Conjugated Lipopolysaccharides (LPS)
MBS2086469-02 0.05 mg

BSA Conjugated Lipopolysaccharides (LPS)

Sign In for Pricing
View Details
BSA Conjugated Lipopolysaccharides (LPS)
MBS2086469-03 0.1 mg

BSA Conjugated Lipopolysaccharides (LPS)

Sign In for Pricing
View Details
BSA Conjugated Lipopolysaccharides (LPS)
MBS2086469-04 0.2 mg

BSA Conjugated Lipopolysaccharides (LPS)

Sign In for Pricing
View Details
BSA Conjugated Lipopolysaccharides (LPS)
MBS2086469-05 0.5 mg

BSA Conjugated Lipopolysaccharides (LPS)

Sign In for Pricing
View Details
BSA Conjugated Lipopolysaccharides (LPS)
MBS2086469-06 1 mg

BSA Conjugated Lipopolysaccharides (LPS)

Sign In for Pricing
View Details