Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC5A1 Peptide - N-terminal region

SLC5A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Sglt1

UniProt

Q8C3K6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_062784.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSPAVTATDAPIPSYERIRNAADISVIVIYFVVVMAVGLWAMFSTNRGTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A 83-01
TRC-A101210-50MG 50 mg

A 83-01

Sign In for Pricing
View Details
Anti-Hu CD8 Pacific Blue™
PB-207-T100 100 Tests

Anti-Hu CD8 Pacific Blue™

Sign In for Pricing
View Details
CD79B (B29, Igbeta, B Cell Antigen Receptor Complex-Associated Protein beta-Chain)
299113 50 µg

CD79B (B29, Igbeta, B Cell Antigen Receptor Complex-Associated Protein beta-Chain)

Sign In for Pricing
View Details
Human GBP5 siRNA
abx917657-01 15 nmol

Human GBP5 siRNA

Sign In for Pricing
View Details
Human GBP5 siRNA
abx917657-02 30 nmol

Human GBP5 siRNA

Sign In for Pricing
View Details
Specific Intracellular Adhesion Molecule Grabbing Nonintegrin R1 (Specific ICAM-3 Grabbing Nonintegrin R1, SIGN-R1, CD209 antigen-like Protein B) discontinued
S5370-90 100 µg

Specific Intracellular Adhesion Molecule Grabbing Nonintegrin R1 (Specific ICAM-3 Grabbing Nonintegrin R1, SIGN-R1, CD209 antigen-like Protein B) discontinued

Sign In for Pricing
View Details