HADHB Peptide - middle region
HADHB Peptide - middle region
Product Specifications
Product Name Alternative
Mtpb, TP-beta, 4930479F15Rik
UniProt
Q99JY0
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001276727.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9016537 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) M17 Polyclonal Antibody
Sign In for Pricing
View Details 
51088126 3x 1.0µg DNA
Zfp691 CRISPRa sgRNA lentivector (set of three targets)(Rat)
Sign In for Pricing
View Details