What is the catalog number for HADHB Peptide - middle region?

The catalog number for HADHB Peptide - middle region is orb1997721.

What sizes are available for HADHB Peptide - middle region?

HADHB Peptide - middle region is available in the following size(s): 100 µg.

Is HADHB Peptide - middle region in stock?

HADHB Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

HADHB Peptide - middle region

Product Specifications

Product Name Alternative

Mtpb, TP-beta, 4930479F15Rik

UniProt

Q99JY0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001276727.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-32097DL594 0.1 mL

Rabbit Polyclonal CD7 Antibody [DyLight 594]

Sign In for Pricing

View Details

VAng-Lsx3980-1mgEcoli 1 mg (E. coli)

Recombinant Bordetella Avium mqo Protein (aa 1-500)

Sign In for Pricing

View Details

LV759656 1.0 µg DNA

CYCSP38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing

View Details

orb2892500 100 µL

DIAPH3 Rabbit pAb, BF555 conjugated

Sign In for Pricing

View Details

PROTP48729-100ug 100 µg

Human CSNK1A1 Recombinant Protein

Sign In for Pricing

View Details

33313164 1.0 µg

Olfr624 AAV siRNA Pooled Vector

Sign In for Pricing

View Details