Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBL2 Peptide - middlel region

MBL2 Peptide - middlel region

Product Specifications

Product Name Alternative

MBL, L-MBP, MBL-C, MBP-C

UniProt

P39039

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034906.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PADI2 siRNA (Rat)
orb1832705-01 15 nmol

PADI2 siRNA (Rat)

Sign In for Pricing
View Details
PADI2 siRNA (Rat)
orb1832705-02 30 nmol

PADI2 siRNA (Rat)

Sign In for Pricing
View Details
Crkl-set siRNA/shRNA/RNAi Lentivector (Rat)
16843096 4x 500 ng

Crkl-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Anti-Mouse CD300b/CD300LB Polyclonal Antibody
MT147014-01 50 µg

Anti-Mouse CD300b/CD300LB Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse CD300b/CD300LB Polyclonal Antibody
MT147014-02 100 µg

Anti-Mouse CD300b/CD300LB Polyclonal Antibody

Sign In for Pricing
View Details
Goat Anti-Human IgG F (ab')2 - Alexa Fluor 488
MBS4517096-01 0.1 mL

Goat Anti-Human IgG F (ab')2 - Alexa Fluor 488

Sign In for Pricing
View Details