Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBL2 Peptide - middlel region

MBL2 Peptide - middlel region

Product Specifications

Product Name Alternative

MBL, L-MBP, MBL-C, MBP-C

UniProt

P39039

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034906.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem42 3'UTR Luciferase Stable Cell Line
TU222131 1.0 mL

Tmem42 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Dihydroxy-acid dehydratase (ilvD), partial
MBS1221519 Inquire

Recombinant Erwinia tasmaniensis Dihydroxy-acid dehydratase (ilvD), partial

Sign In for Pricing
View Details
NSUN6 Polyclonal Antibody, Cy5.5 Conjugated
bs-19484R-Cy5.5 100 µL

NSUN6 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Aloc-D-Ala-Phe-Lys (Aloc) -PAB-PNP
OR471218 1 Each

Aloc-D-Ala-Phe-Lys (Aloc) -PAB-PNP

Sign In for Pricing
View Details
TXNDC9 Rabbit mAb
MBS9467349-01 0.05 mL

TXNDC9 Rabbit mAb

Sign In for Pricing
View Details
TXNDC9 Rabbit mAb
MBS9467349-02 0.1 mL

TXNDC9 Rabbit mAb

Sign In for Pricing
View Details